Name: FOXO4-DRI 10 mg
Brand: AP Labs
SKU: 44249183453249
Price: 170.00 USD
Availability: InStock

Question 1

Is FOXO4-DRI third-party tested?

Accepted Answer

Yes. Every lot of FOXO4-DRI (CAS 2460055-10-9) is tested for identity and purity to ≥99% by HPLC, and a lot-matched Certificate of Analysis is available for each batch.

Question 2

Can I review the Certificate of Analysis before ordering?

Accepted Answer

Yes. The lot-matched COA is linked on this page and covers identity, purity, and the full analytical panel. If a COA isn't shown for the strength you need, AP Labs can send it on request before you order.

Question 3

Who can order FOXO4-DRI 10 mg?

Accepted Answer

AP Labs supplies licensed physicians, clinics, and healthcare practices only. Accounts are verified before ordering is enabled, and this product is not sold to the general public.

Question 4

How should it be stored and handled?

Accepted Answer

Supplied as lyophilized powder. Store lyophilized at -20°C; protect from light and moisture. Reconstitute with bacteriostatic water; refrigerate reconstituted solution at 2-8°C. Soluble in bacteriostatic water; consult the product COA for specific solvent recommendations.

Question 5

How quickly does it ship?

Accepted Answer

Orders confirmed before 12pm CT typically ship the same business day from our U.S. facility with tracking. AP Labs can confirm current lead time and cold-chain handling for your account.

Purity	≥99% by HPLC · COA available
CAS Number	2460055-10-9
Molecular Formula	C228H388N86O64
Molecular Weight	5358.06 g/mol
Amino Acid Count	46
Sequence	All-D retro-inverso 46-mer: ltlrkepaseiaqsileaysqngwanrrsggkrppprrrqrrkkrg (free N-terminus, free acid C-terminus)
Synonyms	FOXO4 D-Retro-Inverso peptide
Physical Form	Lyophilized powder
Solubility	Soluble in bacteriostatic water; consult the product COA for specific solvent recommendations.
Storage	Store lyophilized at -20°C; protect from light and moisture. Reconstitute with bacteriostatic water; refrigerate reconstituted solution at 2-8°C.

FOXO4-DRI

Product details

Quality & handling

Related products

More in Research Peptides