Name: LL-37 10 mg
Brand: AP Labs
SKU: 44249183158337
Price: 70.00 USD
Availability: InStock

Question 1

Is LL-37 third-party tested?

Accepted Answer

Yes. Every lot of LL-37 (CAS 154947-66-7) is tested for identity and purity, and a lot-matched Certificate of Analysis is available for each batch.

Question 2

Can I review the Certificate of Analysis before ordering?

Accepted Answer

Yes. The lot-matched COA is linked on this page and covers identity, purity, and the full analytical panel. If a COA isn't shown for the strength you need, AP Labs can send it on request before you order.

Question 3

Who can order LL-37 10 mg?

Accepted Answer

AP Labs supplies licensed physicians, clinics, and healthcare practices only. Accounts are verified before ordering is enabled, and this product is not sold to the general public.

Question 4

How quickly does it ship?

Accepted Answer

Orders confirmed before 12pm CT typically ship the same business day from our U.S. facility with tracking. AP Labs can confirm current lead time and cold-chain handling for your account.

CAS Number	154947-66-7
Molecular Formula	C205H340N60O53
Molecular Weight	4493.33 g/mol
Amino Acid Count	37
Sequence	[LL-37, 37 aa]
Synonyms	Cathelicidin antimicrobial peptide; hCAP-18(134-170)

LL-37

Product details

Quality & handling

Related products

More in Research Peptides